Placeholder image of a protein
Icon representing a puzzle

1534: Unsolved De-novo Freestyle 134

Closed since over 7 years ago

Intermediate Overall Prediction

Summary

Created
June 13, 2018
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TVRIELEGVDEEIRQWVRELLREVLEKEGGEIELDLQDGHIEIRLENITEERLRELQEKIKKYVENKGGRVEIRE

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 10,800
  2. Avatar for Go Science 2. Go Science 70 pts. 10,793
  3. Avatar for Gargleblasters 3. Gargleblasters 47 pts. 10,733
  4. Avatar for Beta Folders 4. Beta Folders 30 pts. 10,592
  5. Avatar for Marvin's bunch 5. Marvin's bunch 19 pts. 10,533
  6. Avatar for Void Crushers 6. Void Crushers 11 pts. 10,473
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 7 pts. 10,288
  8. Avatar for Contenders 8. Contenders 4 pts. 10,237
  9. Avatar for Team Schleswig-Holstein 9. Team Schleswig-Holstein 2 pts. 10,101
  10. Avatar for FoldIt@Netherlands 10. FoldIt@Netherlands 1 pt. 9,622
  1. Avatar for Deleted player 51. Deleted player pts. 9,885
  2. Avatar for khalan.ysatis 52. khalan.ysatis Lv 1 9 pts. 9,845
  3. Avatar for jausmh 53. jausmh Lv 1 9 pts. 9,844
  4. Avatar for drumpeter18yrs9yrs 54. drumpeter18yrs9yrs Lv 1 8 pts. 9,815
  5. Avatar for YeshuaLives 55. YeshuaLives Lv 1 8 pts. 9,814
  6. Avatar for Deleted player 56. Deleted player pts. 9,771
  7. Avatar for TastyMunchies 57. TastyMunchies Lv 1 7 pts. 9,750
  8. Avatar for katling 58. katling Lv 1 7 pts. 9,731
  9. Avatar for andrewtmaxwell 59. andrewtmaxwell Lv 1 6 pts. 9,729
  10. Avatar for joaniegirl 60. joaniegirl Lv 1 6 pts. 9,691

Comments