Placeholder image of a protein
Icon representing a puzzle

1534: Unsolved De-novo Freestyle 134

Closed since almost 8 years ago

Intermediate Overall Prediction

Summary

Created
June 13, 2018
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TVRIELEGVDEEIRQWVRELLREVLEKEGGEIELDLQDGHIEIRLENITEERLRELQEKIKKYVENKGGRVEIRE

Top groups

  1. Avatar for Richard Dawkins Foundation 11. Richard Dawkins Foundation 1 pt. 9,123
  2. Avatar for Trinity Biology 12. Trinity Biology 1 pt. 8,863
  3. Avatar for Team South Africa 13. Team South Africa 1 pt. 6,608
  4. Avatar for DSN @ Home 14. DSN @ Home 1 pt. 5,702
  5. Avatar for Deleted group 15. Deleted group pts. 5,627
  1. Avatar for silent gene 71. silent gene Lv 1 3 pts. 9,467
  2. Avatar for mitarcher 72. mitarcher Lv 1 3 pts. 9,414
  3. Avatar for weitzen 73. weitzen Lv 1 3 pts. 9,393
  4. Avatar for Merf 74. Merf Lv 1 2 pts. 9,378
  5. Avatar for atlas100 75. atlas100 Lv 1 2 pts. 9,276
  6. Avatar for martin.szew 76. martin.szew Lv 1 2 pts. 9,227
  7. Avatar for momadoc 77. momadoc Lv 1 2 pts. 9,216
  8. Avatar for toshiue 78. toshiue Lv 1 2 pts. 9,197
  9. Avatar for Felix12356 79. Felix12356 Lv 1 2 pts. 9,195
  10. Avatar for hada 80. hada Lv 1 2 pts. 9,178

Comments