Placeholder image of a protein
Icon representing a puzzle

1534: Unsolved De-novo Freestyle 134

Closed since over 7 years ago

Intermediate Overall Prediction

Summary

Created
June 13, 2018
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TVRIELEGVDEEIRQWVRELLREVLEKEGGEIELDLQDGHIEIRLENITEERLRELQEKIKKYVENKGGRVEIRE

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 10,800
  2. Avatar for Go Science 2. Go Science 70 pts. 10,793
  3. Avatar for Gargleblasters 3. Gargleblasters 47 pts. 10,733
  4. Avatar for Beta Folders 4. Beta Folders 30 pts. 10,592
  5. Avatar for Marvin's bunch 5. Marvin's bunch 19 pts. 10,533
  6. Avatar for Void Crushers 6. Void Crushers 11 pts. 10,473
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 7 pts. 10,288
  8. Avatar for Contenders 8. Contenders 4 pts. 10,237
  9. Avatar for Team Schleswig-Holstein 9. Team Schleswig-Holstein 2 pts. 10,101
  10. Avatar for FoldIt@Netherlands 10. FoldIt@Netherlands 1 pt. 9,622
  1. Avatar for silent gene 71. silent gene Lv 1 3 pts. 9,467
  2. Avatar for mitarcher 72. mitarcher Lv 1 3 pts. 9,414
  3. Avatar for weitzen 73. weitzen Lv 1 3 pts. 9,393
  4. Avatar for Merf 74. Merf Lv 1 2 pts. 9,378
  5. Avatar for atlas100 75. atlas100 Lv 1 2 pts. 9,276
  6. Avatar for martin.szew 76. martin.szew Lv 1 2 pts. 9,227
  7. Avatar for momadoc 77. momadoc Lv 1 2 pts. 9,216
  8. Avatar for toshiue 78. toshiue Lv 1 2 pts. 9,197
  9. Avatar for Felix12356 79. Felix12356 Lv 1 2 pts. 9,195
  10. Avatar for hada 80. hada Lv 1 2 pts. 9,178

Comments