Placeholder image of a protein
Icon representing a puzzle

1534: Unsolved De-novo Freestyle 134

Closed since over 7 years ago

Intermediate Overall Prediction

Summary

Created
June 13, 2018
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TVRIELEGVDEEIRQWVRELLREVLEKEGGEIELDLQDGHIEIRLENITEERLRELQEKIKKYVENKGGRVEIRE

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 10,800
  2. Avatar for Go Science 2. Go Science 70 pts. 10,793
  3. Avatar for Gargleblasters 3. Gargleblasters 47 pts. 10,733
  4. Avatar for Beta Folders 4. Beta Folders 30 pts. 10,592
  5. Avatar for Marvin's bunch 5. Marvin's bunch 19 pts. 10,533
  6. Avatar for Void Crushers 6. Void Crushers 11 pts. 10,473
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 7 pts. 10,288
  8. Avatar for Contenders 8. Contenders 4 pts. 10,237
  9. Avatar for Team Schleswig-Holstein 9. Team Schleswig-Holstein 2 pts. 10,101
  10. Avatar for FoldIt@Netherlands 10. FoldIt@Netherlands 1 pt. 9,622
  1. Avatar for WBarme1234 41. WBarme1234 Lv 1 17 pts. 10,066
  2. Avatar for hpaege 42. hpaege Lv 1 16 pts. 10,058
  3. Avatar for smilingone 43. smilingone Lv 1 15 pts. 10,052
  4. Avatar for manu8170 44. manu8170 Lv 1 15 pts. 10,041
  5. Avatar for pvc78 45. pvc78 Lv 1 14 pts. 10,013
  6. Avatar for alwen 46. alwen Lv 1 13 pts. 10,008
  7. Avatar for andrewxc 47. andrewxc Lv 1 12 pts. 9,994
  8. Avatar for alcor29 48. alcor29 Lv 1 12 pts. 9,968
  9. Avatar for jobo0502 49. jobo0502 Lv 1 11 pts. 9,942
  10. Avatar for heather-1 50. heather-1 Lv 1 11 pts. 9,892

Comments