Placeholder image of a protein
Icon representing a puzzle

1535: Revisiting Puzzle 70: Nucleosome Protein

Closed since almost 8 years ago

Intermediate Overall Prediction

Summary

Created
June 18, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein domain is a component of the histone protein complex, which packages DNA into compact units called nucleosomes. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA

Top groups

  1. Avatar for FoldIt@Netherlands 11. FoldIt@Netherlands 2 pts. 10,137
  2. Avatar for Deleted group 12. Deleted group pts. 10,094
  3. Avatar for Richard Dawkins Foundation 13. Richard Dawkins Foundation 1 pt. 9,885
  4. Avatar for DSN @ Home 14. DSN @ Home 1 pt. 9,867
  5. Avatar for fennec's fox hole 15. fennec's fox hole 1 pt. 9,815
  6. Avatar for freefolder 16. freefolder 1 pt. 9,541
  7. Avatar for Team South Africa 17. Team South Africa 1 pt. 9,531
  8. Avatar for Team Schleswig-Holstein 18. Team Schleswig-Holstein 1 pt. 9,502
  1. Avatar for InfoManiac742 111. InfoManiac742 Lv 1 1 pt. 9,649
  2. Avatar for rghuman 112. rghuman Lv 1 1 pt. 9,629
  3. Avatar for DipsyDoodle2016 113. DipsyDoodle2016 Lv 1 1 pt. 9,614
  4. Avatar for trebach 114. trebach Lv 1 1 pt. 9,609
  5. Avatar for Pavel1940 115. Pavel1940 Lv 1 1 pt. 9,608
  6. Avatar for atlas100 116. atlas100 Lv 1 1 pt. 9,592
  7. Avatar for larry25427 117. larry25427 Lv 1 1 pt. 9,586
  8. Avatar for Matthew Hantsbarger 118. Matthew Hantsbarger Lv 1 1 pt. 9,586
  9. Avatar for Altercomp 119. Altercomp Lv 1 1 pt. 9,541
  10. Avatar for tela 120. tela Lv 1 1 pt. 9,539

Comments