Placeholder image of a protein
Icon representing a puzzle

1535: Revisiting Puzzle 70: Nucleosome Protein

Closed since over 7 years ago

Intermediate Overall Prediction

Summary

Created
June 18, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein domain is a component of the histone protein complex, which packages DNA into compact units called nucleosomes. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 10,862
  2. Avatar for Void Crushers 2. Void Crushers 74 pts. 10,857
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 54 pts. 10,802
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 38 pts. 10,790
  5. Avatar for Beta Folders 5. Beta Folders 27 pts. 10,751
  6. Avatar for Contenders 6. Contenders 18 pts. 10,719
  7. Avatar for Marvin's bunch 7. Marvin's bunch 12 pts. 10,693
  8. Avatar for Gargleblasters 8. Gargleblasters 8 pts. 10,642
  9. Avatar for HMT heritage 9. HMT heritage 5 pts. 10,627
  10. Avatar for Trinity Biology 10. Trinity Biology 3 pts. 10,302
  1. Avatar for InfoManiac742 111. InfoManiac742 Lv 1 1 pt. 9,649
  2. Avatar for rghuman 112. rghuman Lv 1 1 pt. 9,629
  3. Avatar for DipsyDoodle2016 113. DipsyDoodle2016 Lv 1 1 pt. 9,614
  4. Avatar for trebach 114. trebach Lv 1 1 pt. 9,609
  5. Avatar for Pavel1940 115. Pavel1940 Lv 1 1 pt. 9,608
  6. Avatar for atlas100 116. atlas100 Lv 1 1 pt. 9,592
  7. Avatar for larry25427 117. larry25427 Lv 1 1 pt. 9,586
  8. Avatar for Matthew Hantsbarger 118. Matthew Hantsbarger Lv 1 1 pt. 9,586
  9. Avatar for Altercomp 119. Altercomp Lv 1 1 pt. 9,541
  10. Avatar for tela 120. tela Lv 1 1 pt. 9,539

Comments