Placeholder image of a protein
Icon representing a puzzle

1535: Revisiting Puzzle 70: Nucleosome Protein

Closed since almost 8 years ago

Intermediate Overall Prediction

Summary

Created
June 18, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein domain is a component of the histone protein complex, which packages DNA into compact units called nucleosomes. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA

Top groups

  1. Avatar for FoldIt@Netherlands 11. FoldIt@Netherlands 2 pts. 10,137
  2. Avatar for Deleted group 12. Deleted group pts. 10,094
  3. Avatar for Richard Dawkins Foundation 13. Richard Dawkins Foundation 1 pt. 9,885
  4. Avatar for DSN @ Home 14. DSN @ Home 1 pt. 9,867
  5. Avatar for fennec's fox hole 15. fennec's fox hole 1 pt. 9,815
  6. Avatar for freefolder 16. freefolder 1 pt. 9,541
  7. Avatar for Team South Africa 17. Team South Africa 1 pt. 9,531
  8. Avatar for Team Schleswig-Holstein 18. Team Schleswig-Holstein 1 pt. 9,502
  1. Avatar for reefyrob 21. reefyrob Lv 1 47 pts. 10,618
  2. Avatar for Blipperman 22. Blipperman Lv 1 45 pts. 10,603
  3. Avatar for Skippysk8s 23. Skippysk8s Lv 1 43 pts. 10,593
  4. Avatar for robgee 24. robgee Lv 1 42 pts. 10,591
  5. Avatar for WBarme1234 25. WBarme1234 Lv 1 40 pts. 10,588
  6. Avatar for katling 26. katling Lv 1 38 pts. 10,582
  7. Avatar for MicElephant 27. MicElephant Lv 1 37 pts. 10,580
  8. Avatar for Flagg65a 28. Flagg65a Lv 1 35 pts. 10,578
  9. Avatar for johnmitch 29. johnmitch Lv 1 34 pts. 10,575
  10. Avatar for gdnskye 30. gdnskye Lv 1 32 pts. 10,571

Comments