Placeholder image of a protein
Icon representing a puzzle

1535: Revisiting Puzzle 70: Nucleosome Protein

Closed since almost 8 years ago

Intermediate Overall Prediction

Summary

Created
June 18, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein domain is a component of the histone protein complex, which packages DNA into compact units called nucleosomes. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA

Top groups

  1. Avatar for FoldIt@Netherlands 11. FoldIt@Netherlands 2 pts. 10,137
  2. Avatar for Deleted group 12. Deleted group pts. 10,094
  3. Avatar for Richard Dawkins Foundation 13. Richard Dawkins Foundation 1 pt. 9,885
  4. Avatar for DSN @ Home 14. DSN @ Home 1 pt. 9,867
  5. Avatar for fennec's fox hole 15. fennec's fox hole 1 pt. 9,815
  6. Avatar for freefolder 16. freefolder 1 pt. 9,541
  7. Avatar for Team South Africa 17. Team South Africa 1 pt. 9,531
  8. Avatar for Team Schleswig-Holstein 18. Team Schleswig-Holstein 1 pt. 9,502
  1. Avatar for hada 81. hada Lv 1 2 pts. 10,023
  2. Avatar for kludbrook 82. kludbrook Lv 1 2 pts. 10,004
  3. Avatar for ViJay7019 83. ViJay7019 Lv 1 2 pts. 9,999
  4. Avatar for dbuske 84. dbuske Lv 1 2 pts. 9,974
  5. Avatar for yoyoparis 85. yoyoparis Lv 1 2 pts. 9,965
  6. Avatar for lconor 86. lconor Lv 1 1 pt. 9,961
  7. Avatar for lamoille 87. lamoille Lv 1 1 pt. 9,955
  8. Avatar for roman madala 88. roman madala Lv 1 1 pt. 9,938
  9. Avatar for ManVsYard 89. ManVsYard Lv 1 1 pt. 9,930
  10. Avatar for leehaggis 90. leehaggis Lv 1 1 pt. 9,915

Comments