Placeholder image of a protein
Icon representing a puzzle

1535: Revisiting Puzzle 70: Nucleosome Protein

Closed since over 7 years ago

Intermediate Overall Prediction

Summary

Created
June 18, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein domain is a component of the histone protein complex, which packages DNA into compact units called nucleosomes. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 10,862
  2. Avatar for Void Crushers 2. Void Crushers 74 pts. 10,857
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 54 pts. 10,802
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 38 pts. 10,790
  5. Avatar for Beta Folders 5. Beta Folders 27 pts. 10,751
  6. Avatar for Contenders 6. Contenders 18 pts. 10,719
  7. Avatar for Marvin's bunch 7. Marvin's bunch 12 pts. 10,693
  8. Avatar for Gargleblasters 8. Gargleblasters 8 pts. 10,642
  9. Avatar for HMT heritage 9. HMT heritage 5 pts. 10,627
  10. Avatar for Trinity Biology 10. Trinity Biology 3 pts. 10,302
  1. Avatar for hada 81. hada Lv 1 2 pts. 10,023
  2. Avatar for kludbrook 82. kludbrook Lv 1 2 pts. 10,004
  3. Avatar for ViJay7019 83. ViJay7019 Lv 1 2 pts. 9,999
  4. Avatar for dbuske 84. dbuske Lv 1 2 pts. 9,974
  5. Avatar for yoyoparis 85. yoyoparis Lv 1 2 pts. 9,965
  6. Avatar for lconor 86. lconor Lv 1 1 pt. 9,961
  7. Avatar for lamoille 87. lamoille Lv 1 1 pt. 9,955
  8. Avatar for roman madala 88. roman madala Lv 1 1 pt. 9,938
  9. Avatar for ManVsYard 89. ManVsYard Lv 1 1 pt. 9,930
  10. Avatar for leehaggis 90. leehaggis Lv 1 1 pt. 9,915

Comments