Placeholder image of a protein
Icon representing a puzzle

1549: Sketchbook Puzzle - Revisiting Puzzle 69: Scorpion Toxin

Closed since over 7 years ago

Intermediate Overall Prediction

Summary

Created
July 16, 2018
Expires
Max points
100
Description

This is another potent neurotoxin produced by scorpions, similar to that found in Puzzle 1542b. This protein contains eight cysteine residues that oxidize to form four disulfide bonds. In this experimental puzzle you will have 256 moves at your disposal. Once you use them up, you can reset and try something else!



Sequence:


MKKNGYPLDRNGKTTECSGVNAIAPHYCNSECTKVYYAESGYCCWGACYCFGLEDDKPIGPMKDITKKYCDVQI

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 10,889
  2. Avatar for Marvin's bunch 2. Marvin's bunch 63 pts. 10,766
  3. Avatar for Go Science 3. Go Science 37 pts. 10,738
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 21 pts. 10,638
  5. Avatar for Void Crushers 5. Void Crushers 11 pts. 10,635
  6. Avatar for Contenders 6. Contenders 5 pts. 10,359
  7. Avatar for Gargleblasters 7. Gargleblasters 2 pts. 10,143
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 1 pt. 9,992
  9. Avatar for freefolder 9. freefolder 1 pt. 9,380
  10. Avatar for FoldIt@Netherlands 10. FoldIt@Netherlands 1 pt. 9,262
  1. Avatar for robgee 11. robgee Lv 1 62 pts. 10,570
  2. Avatar for pvc78 12. pvc78 Lv 1 59 pts. 10,537
  3. Avatar for retiredmichael 13. retiredmichael Lv 1 56 pts. 10,490
  4. Avatar for mirp 14. mirp Lv 1 53 pts. 10,448
  5. Avatar for reefyrob 15. reefyrob Lv 1 51 pts. 10,435
  6. Avatar for Glen B 16. Glen B Lv 1 48 pts. 10,381
  7. Avatar for veroxdraco 17. veroxdraco Lv 1 46 pts. 10,374
  8. Avatar for Bletchley Park 18. Bletchley Park Lv 1 43 pts. 10,359
  9. Avatar for tarimo 19. tarimo Lv 1 41 pts. 10,318
  10. Avatar for Mike Cassidy 20. Mike Cassidy Lv 1 39 pts. 10,280

Comments