Placeholder image of a protein
Icon representing a puzzle

1556: Revisiting Puzzle 73: Polycystein

Closed since over 7 years ago

Intermediate Overall Prediction

Summary

Created
August 01, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This domain is a component of a large glycoprotein in humans that has been linked to autosomal dominant polycystic kidney disease. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ATLVGPHGPLASGQLAAFHIAAPLPVTATRWDFGDGSAEVDAAGPAASHRYVLPGRYHVTAVLALGAGSALLGTDVQVEA

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 10,618
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 68 pts. 10,474
  3. Avatar for Go Science 3. Go Science 44 pts. 10,455
  4. Avatar for Gargleblasters 4. Gargleblasters 27 pts. 10,447
  5. Avatar for Marvin's bunch 5. Marvin's bunch 16 pts. 10,439
  6. Avatar for Void Crushers 6. Void Crushers 9 pts. 10,411
  7. Avatar for Contenders 7. Contenders 5 pts. 10,400
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 3 pts. 10,322
  9. Avatar for HMT heritage 9. HMT heritage 1 pt. 10,189
  10. Avatar for Eὕρηκα! Heureka! 10. Eὕρηκα! Heureka! 1 pt. 8,731
  1. Avatar for Museka 51. Museka Lv 1 9 pts. 9,792
  2. Avatar for diamonddays 52. diamonddays Lv 1 8 pts. 9,760
  3. Avatar for jobo0502 53. jobo0502 Lv 1 8 pts. 9,758
  4. Avatar for Blipperman 54. Blipperman Lv 1 7 pts. 9,731
  5. Avatar for dbuske 55. dbuske Lv 1 7 pts. 9,731
  6. Avatar for Merf 56. Merf Lv 1 6 pts. 9,724
  7. Avatar for ppp6 57. ppp6 Lv 1 6 pts. 9,718
  8. Avatar for katling 58. katling Lv 1 6 pts. 9,664
  9. Avatar for cherry39 59. cherry39 Lv 1 5 pts. 9,647
  10. Avatar for cbwest 60. cbwest Lv 1 5 pts. 9,626

Comments