Placeholder image of a protein
Icon representing a puzzle

1556: Revisiting Puzzle 73: Polycystein

Closed since over 7 years ago

Intermediate Overall Prediction

Summary

Created
August 01, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This domain is a component of a large glycoprotein in humans that has been linked to autosomal dominant polycystic kidney disease. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ATLVGPHGPLASGQLAAFHIAAPLPVTATRWDFGDGSAEVDAAGPAASHRYVLPGRYHVTAVLALGAGSALLGTDVQVEA

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 10,618
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 68 pts. 10,474
  3. Avatar for Go Science 3. Go Science 44 pts. 10,455
  4. Avatar for Gargleblasters 4. Gargleblasters 27 pts. 10,447
  5. Avatar for Marvin's bunch 5. Marvin's bunch 16 pts. 10,439
  6. Avatar for Void Crushers 6. Void Crushers 9 pts. 10,411
  7. Avatar for Contenders 7. Contenders 5 pts. 10,400
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 3 pts. 10,322
  9. Avatar for HMT heritage 9. HMT heritage 1 pt. 10,189
  10. Avatar for Eὕρηκα! Heureka! 10. Eὕρηκα! Heureka! 1 pt. 8,731
  1. Avatar for SouperGenious 71. SouperGenious Lv 1 2 pts. 9,457
  2. Avatar for ManVsYard 72. ManVsYard Lv 1 2 pts. 9,419
  3. Avatar for rabamino12358 73. rabamino12358 Lv 1 2 pts. 9,416
  4. Avatar for rezaefar 74. rezaefar Lv 1 2 pts. 9,412
  5. Avatar for Deleted player 75. Deleted player pts. 9,384
  6. Avatar for Sydefecks 76. Sydefecks Lv 1 2 pts. 9,380
  7. Avatar for hada 77. hada Lv 1 2 pts. 9,349
  8. Avatar for Anfinsen_slept_here 78. Anfinsen_slept_here Lv 1 1 pt. 9,302
  9. Avatar for ourtown 79. ourtown Lv 1 1 pt. 9,299
  10. Avatar for metafolder 80. metafolder Lv 1 1 pt. 9,287

Comments