Placeholder image of a protein
Icon representing a puzzle

1558: Unsolved De-novo Freestyle 137

Closed since over 7 years ago

Intermediate Overall Prediction

Summary


Created
August 06, 2018
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


KEELKKWQKDIRDRLKEMLDRDLKKLDEMRKKGASTEDLRDMEDKIEKKLKKILEELLKWLKSLDDDRDRELIDKLLKELKKQIEDLLEKILKYLRDILRKQS

Top groups


  1. Avatar for Beta Folders 100 pts. 11,503
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 63 pts. 11,427
  3. Avatar for Contenders 3. Contenders 37 pts. 11,392
  4. Avatar for Gargleblasters 4. Gargleblasters 21 pts. 11,366
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 11 pts. 11,350
  6. Avatar for Void Crushers 6. Void Crushers 5 pts. 11,318
  7. Avatar for Marvin's bunch 7. Marvin's bunch 2 pts. 11,305
  8. Avatar for Go Science 8. Go Science 1 pt. 11,247
  9. Avatar for freefolder 9. freefolder 1 pt. 11,069

  1. Avatar for cbwest 61. cbwest Lv 1 5 pts. 10,868
  2. Avatar for manu8170 62. manu8170 Lv 1 4 pts. 10,850
  3. Avatar for Crossed Sticks 63. Crossed Sticks Lv 1 4 pts. 10,846
  4. Avatar for alwen 64. alwen Lv 1 4 pts. 10,839
  5. Avatar for YeshuaLives 65. YeshuaLives Lv 1 4 pts. 10,829
  6. Avatar for silent gene 66. silent gene Lv 1 3 pts. 10,827
  7. Avatar for fpc 67. fpc Lv 1 3 pts. 10,821
  8. Avatar for DoctorSockrates 68. DoctorSockrates Lv 1 3 pts. 10,809
  9. Avatar for anthion 69. anthion Lv 1 3 pts. 10,778
  10. Avatar for SouperGenious 70. SouperGenious Lv 1 3 pts. 10,764

Comments