Placeholder image of a protein
Icon representing a puzzle

1558: Unsolved De-novo Freestyle 137

Closed since over 7 years ago

Intermediate Overall Prediction

Summary

Created
August 06, 2018
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


KEELKKWQKDIRDRLKEMLDRDLKKLDEMRKKGASTEDLRDMEDKIEKKLKKILEELLKWLKSLDDDRDRELIDKLLKELKKQIEDLLEKILKYLRDILRKQS

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 11,503
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 63 pts. 11,427
  3. Avatar for Contenders 3. Contenders 37 pts. 11,392
  4. Avatar for Gargleblasters 4. Gargleblasters 21 pts. 11,366
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 11 pts. 11,350
  6. Avatar for Void Crushers 6. Void Crushers 5 pts. 11,318
  7. Avatar for Marvin's bunch 7. Marvin's bunch 2 pts. 11,305
  8. Avatar for Go Science 8. Go Science 1 pt. 11,247
  9. Avatar for freefolder 9. freefolder 1 pt. 11,069
  10. Avatar for Stuyvesant Molecular Science 2017-18 10. Stuyvesant Molecular Science 2017-18 1 pt. 9,435
  1. Avatar for christioanchauvin 11. christioanchauvin Lv 1 67 pts. 11,350
  2. Avatar for TastyMunchies 12. TastyMunchies Lv 1 64 pts. 11,347
  3. Avatar for Marvelz 13. Marvelz Lv 1 62 pts. 11,334
  4. Avatar for Timo van der Laan 14. Timo van der Laan Lv 1 59 pts. 11,318
  5. Avatar for frood66 15. frood66 Lv 1 57 pts. 11,305
  6. Avatar for reefyrob 16. reefyrob Lv 1 54 pts. 11,290
  7. Avatar for Idiotboy 17. Idiotboy Lv 1 52 pts. 11,267
  8. Avatar for georg137 18. georg137 Lv 1 50 pts. 11,265
  9. Avatar for Threeoak 19. Threeoak Lv 1 47 pts. 11,261
  10. Avatar for MurloW 20. MurloW Lv 1 45 pts. 11,255

Comments