Placeholder image of a protein
Icon representing a puzzle

1558: Unsolved De-novo Freestyle 137

Closed since over 7 years ago

Intermediate Overall Prediction

Summary

Created
August 06, 2018
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


KEELKKWQKDIRDRLKEMLDRDLKKLDEMRKKGASTEDLRDMEDKIEKKLKKILEELLKWLKSLDDDRDRELIDKLLKELKKQIEDLLEKILKYLRDILRKQS

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 11,503
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 63 pts. 11,427
  3. Avatar for Contenders 3. Contenders 37 pts. 11,392
  4. Avatar for Gargleblasters 4. Gargleblasters 21 pts. 11,366
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 11 pts. 11,350
  6. Avatar for Void Crushers 6. Void Crushers 5 pts. 11,318
  7. Avatar for Marvin's bunch 7. Marvin's bunch 2 pts. 11,305
  8. Avatar for Go Science 8. Go Science 1 pt. 11,247
  9. Avatar for freefolder 9. freefolder 1 pt. 11,069
  10. Avatar for Stuyvesant Molecular Science 2017-18 10. Stuyvesant Molecular Science 2017-18 1 pt. 9,435
  1. Avatar for ZeroLeak7 21. ZeroLeak7 Lv 1 43 pts. 11,247
  2. Avatar for Bletchley Park 22. Bletchley Park Lv 1 41 pts. 11,235
  3. Avatar for smilingone 23. smilingone Lv 1 39 pts. 11,229
  4. Avatar for dcrwheeler 24. dcrwheeler Lv 1 38 pts. 11,226
  5. Avatar for Glen B 25. Glen B Lv 1 36 pts. 11,219
  6. Avatar for fiendish_ghoul 26. fiendish_ghoul Lv 1 34 pts. 11,216
  7. Avatar for Skippysk8s 27. Skippysk8s Lv 1 33 pts. 11,216
  8. Avatar for nicobul 28. nicobul Lv 1 31 pts. 11,213
  9. Avatar for NinjaGreg 29. NinjaGreg Lv 1 30 pts. 11,202
  10. Avatar for pvc78 30. pvc78 Lv 1 28 pts. 11,179

Comments