Placeholder image of a protein
Icon representing a puzzle

1558: Unsolved De-novo Freestyle 137

Closed since over 7 years ago

Intermediate Overall Prediction

Summary

Created
August 06, 2018
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


KEELKKWQKDIRDRLKEMLDRDLKKLDEMRKKGASTEDLRDMEDKIEKKLKKILEELLKWLKSLDDDRDRELIDKLLKELKKQIEDLLEKILKYLRDILRKQS

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 11,503
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 63 pts. 11,427
  3. Avatar for Contenders 3. Contenders 37 pts. 11,392
  4. Avatar for Gargleblasters 4. Gargleblasters 21 pts. 11,366
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 11 pts. 11,350
  6. Avatar for Void Crushers 6. Void Crushers 5 pts. 11,318
  7. Avatar for Marvin's bunch 7. Marvin's bunch 2 pts. 11,305
  8. Avatar for Go Science 8. Go Science 1 pt. 11,247
  9. Avatar for freefolder 9. freefolder 1 pt. 11,069
  10. Avatar for Stuyvesant Molecular Science 2017-18 10. Stuyvesant Molecular Science 2017-18 1 pt. 9,435
  1. Avatar for jobo0502 31. jobo0502 Lv 1 27 pts. 11,176
  2. Avatar for johnmitch 32. johnmitch Lv 1 25 pts. 11,166
  3. Avatar for Museka 33. Museka Lv 1 24 pts. 11,164
  4. Avatar for Vinara 34. Vinara Lv 1 23 pts. 11,163
  5. Avatar for JMStiffler 35. JMStiffler Lv 1 22 pts. 11,147
  6. Avatar for diamonddays 36. diamonddays Lv 1 21 pts. 11,146
  7. Avatar for Bruno Kestemont 37. Bruno Kestemont Lv 1 20 pts. 11,128
  8. Avatar for robgee 38. robgee Lv 1 19 pts. 11,111
  9. Avatar for Blipperman 39. Blipperman Lv 1 18 pts. 11,098
  10. Avatar for justjustin 40. justjustin Lv 1 17 pts. 11,087

Comments