Placeholder image of a protein
Icon representing a puzzle

1559: Revisiting Puzzle 74: Platypus Venom

Closed since over 7 years ago

Intermediate Overall Prediction

Summary

Created
August 06, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small peptide was discovered in platypus venom—a rare instance of mammalian-produced venom, although this peptide appears similar to more widespread antimicrobials. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


FVQHRPRDCESINGVCRHKDTVNCREIFLADCYNDGQKCCRK

Top groups

  1. Avatar for Contenders
    1. Contenders
    100 pts. 9,992
  2. Avatar for Beta Folders 2. Beta Folders 65 pts. 9,775
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 41 pts. 9,702
  4. Avatar for Gargleblasters 4. Gargleblasters 24 pts. 9,681
  5. Avatar for Marvin's bunch 5. Marvin's bunch 14 pts. 9,667
  6. Avatar for HMT heritage 6. HMT heritage 7 pts. 9,643
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 4 pts. 9,617
  8. Avatar for Void Crushers 8. Void Crushers 2 pts. 9,611
  9. Avatar for Go Science 9. Go Science 1 pt. 9,588
  10. Avatar for freefolder 10. freefolder 1 pt. 8,406
  1. Avatar for cbwest 61. cbwest Lv 1 4 pts. 8,892
  2. Avatar for Museka 62. Museka Lv 1 4 pts. 8,879
  3. Avatar for andrewxc 63. andrewxc Lv 1 4 pts. 8,772
  4. Avatar for weitzen 64. weitzen Lv 1 4 pts. 8,757
  5. Avatar for pfirth 65. pfirth Lv 1 3 pts. 8,720
  6. Avatar for cobaltteal 66. cobaltteal Lv 1 3 pts. 8,697
  7. Avatar for justjustin 67. justjustin Lv 1 3 pts. 8,690
  8. Avatar for Merf 68. Merf Lv 1 3 pts. 8,683
  9. Avatar for ourtown 69. ourtown Lv 1 2 pts. 8,629
  10. Avatar for leehaggis 70. leehaggis Lv 1 2 pts. 8,598

Comments