Placeholder image of a protein
Icon representing a puzzle

1562: Revisiting Puzzle 75: Antifreeze Protein

Closed since over 7 years ago

Intermediate Overall Prediction

Summary

Created
August 14, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This eelpout protein binds nucleated ice crystals to inhibit their growth. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNRAVPLGTTLMPDMVRGYAA

Top groups

  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 1 pt. 9,633
  2. Avatar for FoldIt@Netherlands 12. FoldIt@Netherlands 1 pt. 9,606
  3. Avatar for Rechenkraft.net 13. Rechenkraft.net 1 pt. 9,583
  4. Avatar for freefolder 14. freefolder 1 pt. 9,522
  5. Avatar for DSN @ Home 15. DSN @ Home 1 pt. 9,296
  6. Avatar for Eὕρηκα! Heureka! 16. Eὕρηκα! Heureka! 1 pt. 9,195
  1. Avatar for Timo van der Laan 11. Timo van der Laan Lv 1 68 pts. 10,102
  2. Avatar for Threeoak 12. Threeoak Lv 1 66 pts. 10,099
  3. Avatar for Galaxie 13. Galaxie Lv 1 63 pts. 10,093
  4. Avatar for drjr 14. drjr Lv 1 61 pts. 10,092
  5. Avatar for bertro 15. bertro Lv 1 58 pts. 10,084
  6. Avatar for tyler0911 16. tyler0911 Lv 1 56 pts. 10,082
  7. Avatar for GetOffMyLawn 17. GetOffMyLawn Lv 1 53 pts. 10,079
  8. Avatar for TastyMunchies 18. TastyMunchies Lv 1 51 pts. 10,074
  9. Avatar for ZeroLeak7 19. ZeroLeak7 Lv 1 49 pts. 10,070
  10. Avatar for johnmitch 20. johnmitch Lv 1 47 pts. 10,067

Comments