Placeholder image of a protein
Icon representing a puzzle

1562: Revisiting Puzzle 75: Antifreeze Protein

Closed since over 7 years ago

Intermediate Overall Prediction

Summary

Created
August 14, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This eelpout protein binds nucleated ice crystals to inhibit their growth. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNRAVPLGTTLMPDMVRGYAA

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 10,182
  2. Avatar for Contenders 2. Contenders 71 pts. 10,153
  3. Avatar for Go Science 3. Go Science 49 pts. 10,143
  4. Avatar for Gargleblasters 4. Gargleblasters 33 pts. 10,137
  5. Avatar for Void Crushers 5. Void Crushers 22 pts. 10,102
  6. Avatar for Anthropic Dreams 6. Anthropic Dreams 14 pts. 10,099
  7. Avatar for HMT heritage 7. HMT heritage 8 pts. 10,066
  8. Avatar for Marvin's bunch 8. Marvin's bunch 5 pts. 10,059
  9. Avatar for L'Alliance Francophone 9. L'Alliance Francophone 3 pts. 10,044
  10. Avatar for Team China 10. Team China 2 pts. 9,740
  1. Avatar for Timo van der Laan 11. Timo van der Laan Lv 1 68 pts. 10,102
  2. Avatar for Threeoak 12. Threeoak Lv 1 66 pts. 10,099
  3. Avatar for Galaxie 13. Galaxie Lv 1 63 pts. 10,093
  4. Avatar for drjr 14. drjr Lv 1 61 pts. 10,092
  5. Avatar for bertro 15. bertro Lv 1 58 pts. 10,084
  6. Avatar for tyler0911 16. tyler0911 Lv 1 56 pts. 10,082
  7. Avatar for GetOffMyLawn 17. GetOffMyLawn Lv 1 53 pts. 10,079
  8. Avatar for TastyMunchies 18. TastyMunchies Lv 1 51 pts. 10,074
  9. Avatar for ZeroLeak7 19. ZeroLeak7 Lv 1 49 pts. 10,070
  10. Avatar for johnmitch 20. johnmitch Lv 1 47 pts. 10,067

Comments