Placeholder image of a protein
Icon representing a puzzle

1562: Revisiting Puzzle 75: Antifreeze Protein

Closed since over 7 years ago

Intermediate Overall Prediction

Summary

Created
August 14, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This eelpout protein binds nucleated ice crystals to inhibit their growth. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNRAVPLGTTLMPDMVRGYAA

Top groups

  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 1 pt. 9,633
  2. Avatar for FoldIt@Netherlands 12. FoldIt@Netherlands 1 pt. 9,606
  3. Avatar for Rechenkraft.net 13. Rechenkraft.net 1 pt. 9,583
  4. Avatar for freefolder 14. freefolder 1 pt. 9,522
  5. Avatar for DSN @ Home 15. DSN @ Home 1 pt. 9,296
  6. Avatar for Eὕρηκα! Heureka! 16. Eὕρηκα! Heureka! 1 pt. 9,195
  1. Avatar for O Seki To 21. O Seki To Lv 1 45 pts. 10,066
  2. Avatar for frood66 22. frood66 Lv 1 43 pts. 10,059
  3. Avatar for pauldunn 23. pauldunn Lv 1 41 pts. 10,056
  4. Avatar for Blipperman 24. Blipperman Lv 1 40 pts. 10,051
  5. Avatar for LociOiling 25. LociOiling Lv 1 38 pts. 10,048
  6. Avatar for robgee 26. robgee Lv 1 36 pts. 10,045
  7. Avatar for nicobul 27. nicobul Lv 1 35 pts. 10,044
  8. Avatar for actiasluna 28. actiasluna Lv 1 33 pts. 10,041
  9. Avatar for guineapig 29. guineapig Lv 1 31 pts. 10,029
  10. Avatar for NinjaGreg 30. NinjaGreg Lv 1 30 pts. 10,026

Comments