Placeholder image of a protein
Icon representing a puzzle

1562: Revisiting Puzzle 75: Antifreeze Protein

Closed since over 7 years ago

Intermediate Overall Prediction

Summary

Created
August 14, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This eelpout protein binds nucleated ice crystals to inhibit their growth. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNRAVPLGTTLMPDMVRGYAA

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 10,182
  2. Avatar for Contenders 2. Contenders 71 pts. 10,153
  3. Avatar for Go Science 3. Go Science 49 pts. 10,143
  4. Avatar for Gargleblasters 4. Gargleblasters 33 pts. 10,137
  5. Avatar for Void Crushers 5. Void Crushers 22 pts. 10,102
  6. Avatar for Anthropic Dreams 6. Anthropic Dreams 14 pts. 10,099
  7. Avatar for HMT heritage 7. HMT heritage 8 pts. 10,066
  8. Avatar for Marvin's bunch 8. Marvin's bunch 5 pts. 10,059
  9. Avatar for L'Alliance Francophone 9. L'Alliance Francophone 3 pts. 10,044
  10. Avatar for Team China 10. Team China 2 pts. 9,740
  1. Avatar for O Seki To 21. O Seki To Lv 1 45 pts. 10,066
  2. Avatar for frood66 22. frood66 Lv 1 43 pts. 10,059
  3. Avatar for pauldunn 23. pauldunn Lv 1 41 pts. 10,056
  4. Avatar for Blipperman 24. Blipperman Lv 1 40 pts. 10,051
  5. Avatar for LociOiling 25. LociOiling Lv 1 38 pts. 10,048
  6. Avatar for robgee 26. robgee Lv 1 36 pts. 10,045
  7. Avatar for nicobul 27. nicobul Lv 1 35 pts. 10,044
  8. Avatar for actiasluna 28. actiasluna Lv 1 33 pts. 10,041
  9. Avatar for guineapig 29. guineapig Lv 1 31 pts. 10,029
  10. Avatar for NinjaGreg 30. NinjaGreg Lv 1 30 pts. 10,026

Comments