Placeholder image of a protein
Icon representing a puzzle

1562: Revisiting Puzzle 75: Antifreeze Protein

Closed since over 7 years ago

Intermediate Overall Prediction

Summary


Created
August 14, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This eelpout protein binds nucleated ice crystals to inhibit their growth. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNRAVPLGTTLMPDMVRGYAA

Top groups


  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 1 pt. 9,633
  2. Avatar for FoldIt@Netherlands 12. FoldIt@Netherlands 1 pt. 9,606
  3. Avatar for Rechenkraft.net 13. Rechenkraft.net 1 pt. 9,583
  4. Avatar for freefolder 14. freefolder 1 pt. 9,522
  5. Avatar for DSN @ Home 15. DSN @ Home 1 pt. 9,296
  6. Avatar for Eὕρηκα! Heureka! 16. Eὕρηκα! Heureka! 1 pt. 9,195

  1. Avatar for pvc78 41. pvc78 Lv 1 17 pts. 9,965
  2. Avatar for smilingone 42. smilingone Lv 1 17 pts. 9,951
  3. Avatar for WBarme1234 43. WBarme1234 Lv 1 16 pts. 9,946
  4. Avatar for cobaltteal 44. cobaltteal Lv 1 15 pts. 9,943
  5. Avatar for Idiotboy 45. Idiotboy Lv 1 14 pts. 9,943
  6. Avatar for stomjoh 46. stomjoh Lv 1 13 pts. 9,935
  7. Avatar for cbwest 47. cbwest Lv 1 13 pts. 9,930
  8. Avatar for isaksson 48. isaksson Lv 1 12 pts. 9,917
  9. Avatar for fiendish_ghoul 49. fiendish_ghoul Lv 1 11 pts. 9,916
  10. Avatar for phi16 50. phi16 Lv 1 11 pts. 9,904

Comments