Placeholder image of a protein
Icon representing a puzzle

1562: Revisiting Puzzle 75: Antifreeze Protein

Closed since over 7 years ago

Intermediate Overall Prediction

Summary

Created
August 14, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This eelpout protein binds nucleated ice crystals to inhibit their growth. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNRAVPLGTTLMPDMVRGYAA

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 10,182
  2. Avatar for Contenders 2. Contenders 71 pts. 10,153
  3. Avatar for Go Science 3. Go Science 49 pts. 10,143
  4. Avatar for Gargleblasters 4. Gargleblasters 33 pts. 10,137
  5. Avatar for Void Crushers 5. Void Crushers 22 pts. 10,102
  6. Avatar for Anthropic Dreams 6. Anthropic Dreams 14 pts. 10,099
  7. Avatar for HMT heritage 7. HMT heritage 8 pts. 10,066
  8. Avatar for Marvin's bunch 8. Marvin's bunch 5 pts. 10,059
  9. Avatar for L'Alliance Francophone 9. L'Alliance Francophone 3 pts. 10,044
  10. Avatar for Team China 10. Team China 2 pts. 9,740
  1. Avatar for pvc78 41. pvc78 Lv 1 17 pts. 9,965
  2. Avatar for smilingone 42. smilingone Lv 1 17 pts. 9,951
  3. Avatar for WBarme1234 43. WBarme1234 Lv 1 16 pts. 9,946
  4. Avatar for cobaltteal 44. cobaltteal Lv 1 15 pts. 9,943
  5. Avatar for Idiotboy 45. Idiotboy Lv 1 14 pts. 9,943
  6. Avatar for stomjoh 46. stomjoh Lv 1 13 pts. 9,935
  7. Avatar for cbwest 47. cbwest Lv 1 13 pts. 9,930
  8. Avatar for isaksson 48. isaksson Lv 1 12 pts. 9,917
  9. Avatar for fiendish_ghoul 49. fiendish_ghoul Lv 1 11 pts. 9,916
  10. Avatar for phi16 50. phi16 Lv 1 11 pts. 9,904

Comments