Placeholder image of a protein
Icon representing a puzzle

1562: Revisiting Puzzle 75: Antifreeze Protein

Closed since over 7 years ago

Intermediate Overall Prediction

Summary


Created
August 14, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This eelpout protein binds nucleated ice crystals to inhibit their growth. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNRAVPLGTTLMPDMVRGYAA

Top groups


  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 1 pt. 9,633
  2. Avatar for FoldIt@Netherlands 12. FoldIt@Netherlands 1 pt. 9,606
  3. Avatar for Rechenkraft.net 13. Rechenkraft.net 1 pt. 9,583
  4. Avatar for freefolder 14. freefolder 1 pt. 9,522
  5. Avatar for DSN @ Home 15. DSN @ Home 1 pt. 9,296
  6. Avatar for Eὕρηκα! Heureka! 16. Eὕρηκα! Heureka! 1 pt. 9,195

  1. Avatar for Kevin76 71. Kevin76 Lv 1 3 pts. 9,740
  2. Avatar for Sci1217 72. Sci1217 Lv 1 3 pts. 9,733
  3. Avatar for Merf 73. Merf Lv 1 3 pts. 9,723
  4. Avatar for Jesse Pinkman 74. Jesse Pinkman Lv 1 2 pts. 9,700
  5. Avatar for ManVsYard 75. ManVsYard Lv 1 2 pts. 9,699
  6. Avatar for Marvelz 76. Marvelz Lv 1 2 pts. 9,695
  7. Avatar for katling 77. katling Lv 1 2 pts. 9,689
  8. Avatar for anthion 78. anthion Lv 1 2 pts. 9,686
  9. Avatar for ViJay7019 79. ViJay7019 Lv 1 2 pts. 9,685
  10. Avatar for leehaggis 80. leehaggis Lv 1 2 pts. 9,668

Comments