Placeholder image of a protein
Icon representing a puzzle

1577: Revisiting Puzzle 81: Calcium Ion Binding Protein

Closed since over 7 years ago

Novice Overall Prediction

Summary

Created
September 26, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein, which inhibits muscle contraction in the absence of calcium ions, changes conformation in the presence of calcium to allow muscle contraction. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


QAEARAFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups

  1. Avatar for FoldIt@Netherlands 11. FoldIt@Netherlands 1 pt. 9,946
  2. Avatar for freefolder 12. freefolder 1 pt. 9,748
  1. Avatar for Knoblerine 81. Knoblerine Lv 1 2 pts. 9,807
  2. Avatar for atlas100 82. atlas100 Lv 1 2 pts. 9,802
  3. Avatar for YorPrints 83. YorPrints Lv 1 2 pts. 9,797
  4. Avatar for dbuske 84. dbuske Lv 1 2 pts. 9,786
  5. Avatar for roman madala 85. roman madala Lv 1 1 pt. 9,775
  6. Avatar for kludbrook 86. kludbrook Lv 1 1 pt. 9,769
  7. Avatar for rabamino12358 87. rabamino12358 Lv 1 1 pt. 9,767
  8. Avatar for rinze 88. rinze Lv 1 1 pt. 9,761
  9. Avatar for ManVsYard 89. ManVsYard Lv 1 1 pt. 9,760
  10. Avatar for Noah_Quinn 90. Noah_Quinn Lv 1 1 pt. 9,750

Comments