Placeholder image of a protein
Icon representing a puzzle

1577: Revisiting Puzzle 81: Calcium Ion Binding Protein

Closed since over 7 years ago

Novice Overall Prediction

Summary

Created
September 26, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein, which inhibits muscle contraction in the absence of calcium ions, changes conformation in the presence of calcium to allow muscle contraction. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


QAEARAFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 10,771
  2. Avatar for Go Science 2. Go Science 63 pts. 10,670
  3. Avatar for Void Crushers 3. Void Crushers 37 pts. 10,657
  4. Avatar for Contenders 4. Contenders 21 pts. 10,653
  5. Avatar for Anthropic Dreams 5. Anthropic Dreams 11 pts. 10,629
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 5 pts. 10,535
  7. Avatar for HMT heritage 7. HMT heritage 2 pts. 10,505
  8. Avatar for Marvin's bunch 8. Marvin's bunch 1 pt. 10,450
  9. Avatar for Gargleblasters 9. Gargleblasters 1 pt. 10,361
  10. Avatar for Russian team 10. Russian team 1 pt. 10,003
  1. Avatar for Knoblerine 81. Knoblerine Lv 1 2 pts. 9,807
  2. Avatar for atlas100 82. atlas100 Lv 1 2 pts. 9,802
  3. Avatar for YorPrints 83. YorPrints Lv 1 2 pts. 9,797
  4. Avatar for dbuske 84. dbuske Lv 1 2 pts. 9,786
  5. Avatar for roman madala 85. roman madala Lv 1 1 pt. 9,775
  6. Avatar for kludbrook 86. kludbrook Lv 1 1 pt. 9,769
  7. Avatar for rabamino12358 87. rabamino12358 Lv 1 1 pt. 9,767
  8. Avatar for rinze 88. rinze Lv 1 1 pt. 9,761
  9. Avatar for ManVsYard 89. ManVsYard Lv 1 1 pt. 9,760
  10. Avatar for Noah_Quinn 90. Noah_Quinn Lv 1 1 pt. 9,750

Comments