Placeholder image of a protein
Icon representing a puzzle

1579: 221-residue Cryo-EM Multi-Start Puzzle

Closed since over 7 years ago

Intermediate Overall Prediction

Summary

Created
October 01, 2018
Expires
Max points
100
Description

This bigger protein is another part of the same protein complex with multiple subunits from Puzzle 1554, which has been the target of cryo-EM experiments. We are giving you 5 different server predictions as starting points. Reset the puzzle to cycle through the different starting models.

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 12,453
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 71 pts. 12,429
  3. Avatar for Contenders 3. Contenders 49 pts. 12,029
  4. Avatar for Go Science 4. Go Science 33 pts. 11,885
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 22 pts. 11,730
  6. Avatar for Void Crushers 6. Void Crushers 14 pts. 11,543
  7. Avatar for Marvin's bunch 7. Marvin's bunch 8 pts. 11,450
  8. Avatar for HMT heritage 8. HMT heritage 5 pts. 10,510
  9. Avatar for Gargleblasters 9. Gargleblasters 3 pts. 9,924
  10. Avatar for freefolder 10. freefolder 2 pts. 8,408
  1. Avatar for diamonddays 31. diamonddays Lv 1 27 pts. 10,590
  2. Avatar for O Seki To 32. O Seki To Lv 1 26 pts. 10,510
  3. Avatar for fpc 33. fpc Lv 1 25 pts. 10,483
  4. Avatar for pvc78 34. pvc78 Lv 1 24 pts. 10,434
  5. Avatar for joremen 35. joremen Lv 1 22 pts. 10,357
  6. Avatar for Maerlyn138 36. Maerlyn138 Lv 1 21 pts. 10,349
  7. Avatar for Jesse Pinkman 37. Jesse Pinkman Lv 1 20 pts. 10,222
  8. Avatar for MicElephant 38. MicElephant Lv 1 19 pts. 10,189
  9. Avatar for rezaefar 39. rezaefar Lv 1 18 pts. 10,119
  10. Avatar for YeshuaLives 40. YeshuaLives Lv 1 17 pts. 10,088

Comments

Susume Lv 1

SKLTLNAWKDREGKIPAGSMSAMYNPETIQLDYQTRFDTEDTINTASQ
SNRYVISEPVGLNLTLLFDSQMPGNTTPIETQLAMLKSLCAVDAATGSP
YFLRITWGKMRWENKGWFAGRARDLSVTYTLFDRDATPLRATVQLSL
VADESFVIQQSLKTQSAPDRALVSVPDLASLPLLALSAGGVLASSVDYL
SLAWDNDLDNLDDFQTGDFLRATKGEEV