Placeholder image of a protein
Icon representing a puzzle

1593: Revisiting Puzzle 84: Giant Anemone

Closed since over 7 years ago

Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
October 29, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, which is released by the sea anemone A. xanthogrammica, disrupts normal contraction of cardiac muscle in potential predators, and furthermore serves as a pheromone to signal danger to nearby anemones. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


GVSCLCDSDGPSVRGNTLSGTLWLYPSGCPSGWHNCKAHGPTIGWCCKQ

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 9,886
  2. Avatar for Go Science 2. Go Science 71 pts. 9,787
  3. Avatar for Gargleblasters 3. Gargleblasters 49 pts. 9,765
  4. Avatar for Beta Folders 4. Beta Folders 33 pts. 9,741
  5. Avatar for Void Crushers 5. Void Crushers 22 pts. 9,739
  6. Avatar for Marvin's bunch 6. Marvin's bunch 14 pts. 9,696
  7. Avatar for Contenders 7. Contenders 8 pts. 9,675
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 5 pts. 9,603
  9. Avatar for HMT heritage 9. HMT heritage 3 pts. 9,428
  10. Avatar for Russian team 10. Russian team 2 pts. 9,288

  1. Avatar for GUANINJIN 101. GUANINJIN Lv 1 1 pt. 7,937
  2. Avatar for icaru-5 102. icaru-5 Lv 1 1 pt. 7,907
  3. Avatar for pielie 103. pielie Lv 1 1 pt. 7,898
  4. Avatar for west.elsdon 104. west.elsdon Lv 1 1 pt. 7,892
  5. Avatar for ivalnic 105. ivalnic Lv 1 1 pt. 7,857
  6. Avatar for antibot215 106. antibot215 Lv 1 1 pt. 7,791
  7. Avatar for frostschutz 107. frostschutz Lv 1 1 pt. 7,780
  8. Avatar for micheldeweerd 108. micheldeweerd Lv 1 1 pt. 7,779
  9. Avatar for lamoille 109. lamoille Lv 1 1 pt. 7,754
  10. Avatar for oaks 110. oaks Lv 1 1 pt. 7,729

Comments