Placeholder image of a protein
Icon representing a puzzle

1596: Revisiting Puzzle 85: Cell Adhesion Protein

Closed since over 7 years ago

Novice Overall Prediction

Summary

Created
November 06, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is part of a larger protein that mediates interactions between other proteins in human development. This protein contains several cysteine residues, but we are modeling them in a reducing environment, so they should NOT form disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

MANALASATCERCKGGFAPAEKIVNSNGELYHEQCFVCAQCFQQFPEGLFYEFEGRKYCEHDFQMLFAPC

Top groups

  1. Avatar for Russian team 11. Russian team 1 pt. 9,070
  2. Avatar for freefolder 12. freefolder 1 pt. 8,837
  3. Avatar for Minions of TWIS 13. Minions of TWIS 1 pt. 8,765
  4. Avatar for Czech National Team 14. Czech National Team 1 pt. 8,735
  5. Avatar for Trinity Biology 15. Trinity Biology 1 pt. 8,404
  1. Avatar for Buffalo-Phil 91. Buffalo-Phil Lv 1 1 pt. 8,552
  2. Avatar for Squirrely 92. Squirrely Lv 1 1 pt. 8,532
  3. Avatar for lamoille 93. lamoille Lv 1 1 pt. 8,518
  4. Avatar for Arne Heessels 94. Arne Heessels Lv 1 1 pt. 8,512
  5. Avatar for micheldeweerd 95. micheldeweerd Lv 1 1 pt. 8,493
  6. Avatar for tarimo 96. tarimo Lv 1 1 pt. 8,478
  7. Avatar for Amphimixus 97. Amphimixus Lv 1 1 pt. 8,452
  8. Avatar for antibot215 98. antibot215 Lv 1 1 pt. 8,429
  9. Avatar for PlagueRat 99. PlagueRat Lv 1 1 pt. 8,415
  10. Avatar for Mao Mao 100. Mao Mao Lv 1 1 pt. 8,408

Comments