Placeholder image of a protein
Icon representing a puzzle

1596: Revisiting Puzzle 85: Cell Adhesion Protein

Closed since over 7 years ago

Novice Overall Prediction

Summary

Created
November 06, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is part of a larger protein that mediates interactions between other proteins in human development. This protein contains several cysteine residues, but we are modeling them in a reducing environment, so they should NOT form disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

MANALASATCERCKGGFAPAEKIVNSNGELYHEQCFVCAQCFQQFPEGLFYEFEGRKYCEHDFQMLFAPC

Top groups

  1. Avatar for Russian team 11. Russian team 1 pt. 9,070
  2. Avatar for freefolder 12. freefolder 1 pt. 8,837
  3. Avatar for Minions of TWIS 13. Minions of TWIS 1 pt. 8,765
  4. Avatar for Czech National Team 14. Czech National Team 1 pt. 8,735
  5. Avatar for Trinity Biology 15. Trinity Biology 1 pt. 8,404
  1. Avatar for ourtown 41. ourtown Lv 1 19 pts. 9,333
  2. Avatar for pvc78 42. pvc78 Lv 1 18 pts. 9,321
  3. Avatar for Maerlyn138 43. Maerlyn138 Lv 1 17 pts. 9,321
  4. Avatar for fisherlr777 44. fisherlr777 Lv 1 16 pts. 9,317
  5. Avatar for Kaputnik 45. Kaputnik Lv 1 15 pts. 9,313
  6. Avatar for Merf 46. Merf Lv 1 14 pts. 9,308
  7. Avatar for dd-2 47. dd-2 Lv 1 14 pts. 9,307
  8. Avatar for isaksson 48. isaksson Lv 1 13 pts. 9,301
  9. Avatar for Bletchley Park 49. Bletchley Park Lv 1 12 pts. 9,293
  10. Avatar for christioanchauvin 50. christioanchauvin Lv 1 12 pts. 9,256

Comments