Placeholder image of a protein
Icon representing a puzzle

1596: Revisiting Puzzle 85: Cell Adhesion Protein

Closed since over 7 years ago

Novice Overall Prediction

Summary

Created
November 06, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is part of a larger protein that mediates interactions between other proteins in human development. This protein contains several cysteine residues, but we are modeling them in a reducing environment, so they should NOT form disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

MANALASATCERCKGGFAPAEKIVNSNGELYHEQCFVCAQCFQQFPEGLFYEFEGRKYCEHDFQMLFAPC

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 9,902
  2. Avatar for Contenders 2. Contenders 70 pts. 9,833
  3. Avatar for Beta Folders 3. Beta Folders 47 pts. 9,803
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 30 pts. 9,780
  5. Avatar for Gargleblasters 5. Gargleblasters 19 pts. 9,777
  6. Avatar for Void Crushers 6. Void Crushers 11 pts. 9,769
  7. Avatar for Go Science 7. Go Science 7 pts. 9,687
  8. Avatar for Marvin's bunch 8. Marvin's bunch 4 pts. 9,668
  9. Avatar for Deleted group 9. Deleted group pts. 9,588
  10. Avatar for HMT heritage 10. HMT heritage 1 pt. 9,393
  1. Avatar for ourtown 41. ourtown Lv 1 19 pts. 9,333
  2. Avatar for pvc78 42. pvc78 Lv 1 18 pts. 9,321
  3. Avatar for Maerlyn138 43. Maerlyn138 Lv 1 17 pts. 9,321
  4. Avatar for fisherlr777 44. fisherlr777 Lv 1 16 pts. 9,317
  5. Avatar for Kaputnik 45. Kaputnik Lv 1 15 pts. 9,313
  6. Avatar for Merf 46. Merf Lv 1 14 pts. 9,308
  7. Avatar for dd-2 47. dd-2 Lv 1 14 pts. 9,307
  8. Avatar for isaksson 48. isaksson Lv 1 13 pts. 9,301
  9. Avatar for Bletchley Park 49. Bletchley Park Lv 1 12 pts. 9,293
  10. Avatar for christioanchauvin 50. christioanchauvin Lv 1 12 pts. 9,256

Comments