Placeholder image of a protein
Icon representing a puzzle

1596: Revisiting Puzzle 85: Cell Adhesion Protein

Closed since over 7 years ago

Novice Overall Prediction

Summary

Created
November 06, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is part of a larger protein that mediates interactions between other proteins in human development. This protein contains several cysteine residues, but we are modeling them in a reducing environment, so they should NOT form disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

MANALASATCERCKGGFAPAEKIVNSNGELYHEQCFVCAQCFQQFPEGLFYEFEGRKYCEHDFQMLFAPC

Top groups

  1. Avatar for Russian team 11. Russian team 1 pt. 9,070
  2. Avatar for freefolder 12. freefolder 1 pt. 8,837
  3. Avatar for Minions of TWIS 13. Minions of TWIS 1 pt. 8,765
  4. Avatar for Czech National Team 14. Czech National Team 1 pt. 8,735
  5. Avatar for Trinity Biology 15. Trinity Biology 1 pt. 8,404
  1. Avatar for ViJay7019 61. ViJay7019 Lv 1 6 pts. 9,031
  2. Avatar for alwen 62. alwen Lv 1 6 pts. 9,018
  3. Avatar for Hellcat6 63. Hellcat6 Lv 1 6 pts. 9,015
  4. Avatar for Deleted player 64. Deleted player pts. 9,004
  5. Avatar for cbwest 65. cbwest Lv 1 5 pts. 8,978
  6. Avatar for Psych0Active 66. Psych0Active Lv 1 5 pts. 8,973
  7. Avatar for cobaltteal 67. cobaltteal Lv 1 4 pts. 8,960
  8. Avatar for Knoblerine 68. Knoblerine Lv 1 4 pts. 8,957
  9. Avatar for RyeSnake 69. RyeSnake Lv 1 4 pts. 8,957
  10. Avatar for Deleted player 70. Deleted player pts. 8,954

Comments