Placeholder image of a protein
Icon representing a puzzle

1596: Revisiting Puzzle 85: Cell Adhesion Protein

Closed since over 7 years ago

Novice Overall Prediction

Summary

Created
November 06, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is part of a larger protein that mediates interactions between other proteins in human development. This protein contains several cysteine residues, but we are modeling them in a reducing environment, so they should NOT form disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

MANALASATCERCKGGFAPAEKIVNSNGELYHEQCFVCAQCFQQFPEGLFYEFEGRKYCEHDFQMLFAPC

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 9,902
  2. Avatar for Contenders 2. Contenders 70 pts. 9,833
  3. Avatar for Beta Folders 3. Beta Folders 47 pts. 9,803
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 30 pts. 9,780
  5. Avatar for Gargleblasters 5. Gargleblasters 19 pts. 9,777
  6. Avatar for Void Crushers 6. Void Crushers 11 pts. 9,769
  7. Avatar for Go Science 7. Go Science 7 pts. 9,687
  8. Avatar for Marvin's bunch 8. Marvin's bunch 4 pts. 9,668
  9. Avatar for Deleted group 9. Deleted group pts. 9,588
  10. Avatar for HMT heritage 10. HMT heritage 1 pt. 9,393
  1. Avatar for jamiexq 31. jamiexq Lv 1 30 pts. 9,464
  2. Avatar for MicElephant 32. MicElephant Lv 1 29 pts. 9,462
  3. Avatar for weitzen 33. weitzen Lv 1 27 pts. 9,455
  4. Avatar for guineapig 34. guineapig Lv 1 26 pts. 9,450
  5. Avatar for Glen B 35. Glen B Lv 1 25 pts. 9,446
  6. Avatar for aznarog 36. aznarog Lv 1 24 pts. 9,440
  7. Avatar for Deleted player 37. Deleted player pts. 9,394
  8. Avatar for O Seki To 38. O Seki To Lv 1 21 pts. 9,393
  9. Avatar for WBarme1234 39. WBarme1234 Lv 1 20 pts. 9,358
  10. Avatar for Flagg65a 40. Flagg65a Lv 1 20 pts. 9,346

Comments