Placeholder image of a protein
Icon representing a puzzle

1612: Unsolved De-novo Freestyle 139

Closed since over 7 years ago

Intermediate Overall Prediction

Summary

Created
December 20, 2018
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


PELEERLKTWLKIWYELMKKLLTWIAKVVSDEEFLKKVYKTMLEMMKEMWKILMEVLKKEEDLKKVIEIAIKFLIDLKRWMEDLKKKILS

Top groups

  1. Avatar for Hold My Beer 11. Hold My Beer 4 pts. 10,445
  2. Avatar for HMT heritage 12. HMT heritage 2 pts. 10,344
  3. Avatar for Deleted group 13. Deleted group pts. 9,224
  4. Avatar for Dutch Power Cows 14. Dutch Power Cows 1 pt. 9,088
  5. Avatar for freefolder 15. freefolder 1 pt. 8,896
  6. Avatar for DW 2020 16. DW 2020 1 pt. 8,572
  7. Avatar for Rechenkraft.net 17. Rechenkraft.net 1 pt. 8,264
  8. Avatar for FoldIt@Poland 18. FoldIt@Poland 1 pt. 6,869
  9. Avatar for Kotocycle 19. Kotocycle 1 pt. 6,829
  10. Avatar for Czech National Team 20. Czech National Team 1 pt. 0
  1. Avatar for ehhan2018 101. ehhan2018 Lv 1 1 pt. 8,572
  2. Avatar for RedEight 102. RedEight Lv 1 1 pt. 8,568
  3. Avatar for multaq 103. multaq Lv 1 1 pt. 8,556
  4. Avatar for JasperD 104. JasperD Lv 1 1 pt. 8,515
  5. Avatar for kludbrook 105. kludbrook Lv 1 1 pt. 8,473
  6. Avatar for alwan2018 106. alwan2018 Lv 1 1 pt. 8,468
  7. Avatar for Idiotboy 107. Idiotboy Lv 1 1 pt. 8,466
  8. Avatar for dbuske 108. dbuske Lv 1 1 pt. 8,421
  9. Avatar for Ricardo Oliveira 109. Ricardo Oliveira Lv 1 1 pt. 8,379
  10. Avatar for carsonfb 110. carsonfb Lv 1 1 pt. 8,351

Comments