Placeholder image of a protein
Icon representing a puzzle

1612: Unsolved De-novo Freestyle 139

Closed since about 7 years ago

Intermediate Overall Prediction

Summary


Created
December 20, 2018
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


PELEERLKTWLKIWYELMKKLLTWIAKVVSDEEFLKKVYKTMLEMMKEMWKILMEVLKKEEDLKKVIEIAIKFLIDLKRWMEDLKKKILS

Top groups


  1. Avatar for Beta Folders 100 pts. 11,121
  2. Avatar for Contenders 2. Contenders 78 pts. 11,068
  3. Avatar for Void Crushers 3. Void Crushers 60 pts. 10,974
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 45 pts. 10,907
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 33 pts. 10,850
  6. Avatar for Gargleblasters 6. Gargleblasters 24 pts. 10,720
  7. Avatar for Go Science 7. Go Science 17 pts. 10,672
  8. Avatar for Russian team 8. Russian team 12 pts. 10,643
  9. Avatar for Marvin's bunch 9. Marvin's bunch 8 pts. 10,627
  10. Avatar for FoldIt@Netherlands 10. FoldIt@Netherlands 6 pts. 10,508

  1. Avatar for ehhan2018 101. ehhan2018 Lv 1 1 pt. 8,572
  2. Avatar for RedEight 102. RedEight Lv 1 1 pt. 8,568
  3. Avatar for multaq 103. multaq Lv 1 1 pt. 8,556
  4. Avatar for JasperD 104. JasperD Lv 1 1 pt. 8,515
  5. Avatar for kludbrook 105. kludbrook Lv 1 1 pt. 8,473
  6. Avatar for alwan2018 106. alwan2018 Lv 1 1 pt. 8,468
  7. Avatar for Idiotboy 107. Idiotboy Lv 1 1 pt. 8,466
  8. Avatar for dbuske 108. dbuske Lv 1 1 pt. 8,421
  9. Avatar for Ricardo Oliveira 109. Ricardo Oliveira Lv 1 1 pt. 8,379
  10. Avatar for carsonfb 110. carsonfb Lv 1 1 pt. 8,351

Comments