Placeholder image of a protein
Icon representing a puzzle

1612: Unsolved De-novo Freestyle 139

Closed since over 7 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary


Created
December 20, 2018
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


PELEERLKTWLKIWYELMKKLLTWIAKVVSDEEFLKKVYKTMLEMMKEMWKILMEVLKKEEDLKKVIEIAIKFLIDLKRWMEDLKKKILS

Top groups


  1. Avatar for Hold My Beer 11. Hold My Beer 4 pts. 10,445
  2. Avatar for HMT heritage 12. HMT heritage 2 pts. 10,344
  3. Avatar for Deleted group 13. Deleted group pts. 9,224
  4. Avatar for Dutch Power Cows 14. Dutch Power Cows 1 pt. 9,088
  5. Avatar for freefolder 15. freefolder 1 pt. 8,896
  6. Avatar for DW 2020 16. DW 2020 1 pt. 8,572
  7. Avatar for Rechenkraft.net 17. Rechenkraft.net 1 pt. 8,264
  8. Avatar for FoldIt@Poland 18. FoldIt@Poland 1 pt. 6,869
  9. Avatar for Kotocycle 19. Kotocycle 1 pt. 6,829

  1. Avatar for Nementil 141. Nementil Lv 1 1 pt. 4,918
  2. Avatar for raptorchief42 142. raptorchief42 Lv 1 1 pt. 4,845
  3. Avatar for Thebatman012 143. Thebatman012 Lv 1 1 pt. 4,699
  4. Avatar for 875 144. 875 Lv 1 1 pt. 4,659
  5. Avatar for yavij2019 145. yavij2019 Lv 1 1 pt. 4,600
  6. Avatar for Singam 146. Singam Lv 1 1 pt. 4,474
  7. Avatar for xuzhengnjtech 147. xuzhengnjtech Lv 1 1 pt. 4,405
  8. Avatar for S898 148. S898 Lv 1 1 pt. 4,396
  9. Avatar for ManVsYard 149. ManVsYard Lv 1 1 pt. 3,890
  10. Avatar for blueridanus 150. blueridanus Lv 1 1 pt. 3,331

Comments