Placeholder image of a protein
Icon representing a puzzle

1612: Unsolved De-novo Freestyle 139

Closed since about 7 years ago

Intermediate Overall Prediction

Summary

Created
December 20, 2018
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


PELEERLKTWLKIWYELMKKLLTWIAKVVSDEEFLKKVYKTMLEMMKEMWKILMEVLKKEEDLKKVIEIAIKFLIDLKRWMEDLKKKILS

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 11,121
  2. Avatar for Contenders 2. Contenders 78 pts. 11,068
  3. Avatar for Void Crushers 3. Void Crushers 60 pts. 10,974
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 45 pts. 10,907
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 33 pts. 10,850
  6. Avatar for Gargleblasters 6. Gargleblasters 24 pts. 10,720
  7. Avatar for Go Science 7. Go Science 17 pts. 10,672
  8. Avatar for Russian team 8. Russian team 12 pts. 10,643
  9. Avatar for Marvin's bunch 9. Marvin's bunch 8 pts. 10,627
  10. Avatar for FoldIt@Netherlands 10. FoldIt@Netherlands 6 pts. 10,508
  1. Avatar for Nementil 141. Nementil Lv 1 1 pt. 4,918
  2. Avatar for raptorchief42 142. raptorchief42 Lv 1 1 pt. 4,845
  3. Avatar for Thebatman012 143. Thebatman012 Lv 1 1 pt. 4,699
  4. Avatar for 875 144. 875 Lv 1 1 pt. 4,659
  5. Avatar for yavij2019 145. yavij2019 Lv 1 1 pt. 4,600
  6. Avatar for Singam 146. Singam Lv 1 1 pt. 4,474
  7. Avatar for xuzhengnjtech 147. xuzhengnjtech Lv 1 1 pt. 4,405
  8. Avatar for S898 148. S898 Lv 1 1 pt. 4,396
  9. Avatar for ManVsYard 149. ManVsYard Lv 1 1 pt. 3,890
  10. Avatar for blueridanus 150. blueridanus Lv 1 1 pt. 3,331

Comments