Placeholder image of a protein
Icon representing a puzzle

1612: Unsolved De-novo Freestyle 139

Closed since over 7 years ago

Intermediate Overall Prediction

Summary

Created
December 20, 2018
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


PELEERLKTWLKIWYELMKKLLTWIAKVVSDEEFLKKVYKTMLEMMKEMWKILMEVLKKEEDLKKVIEIAIKFLIDLKRWMEDLKKKILS

Top groups

  1. Avatar for Hold My Beer 11. Hold My Beer 4 pts. 10,445
  2. Avatar for HMT heritage 12. HMT heritage 2 pts. 10,344
  3. Avatar for Deleted group 13. Deleted group pts. 9,224
  4. Avatar for Dutch Power Cows 14. Dutch Power Cows 1 pt. 9,088
  5. Avatar for freefolder 15. freefolder 1 pt. 8,896
  6. Avatar for DW 2020 16. DW 2020 1 pt. 8,572
  7. Avatar for Rechenkraft.net 17. Rechenkraft.net 1 pt. 8,264
  8. Avatar for FoldIt@Poland 18. FoldIt@Poland 1 pt. 6,869
  9. Avatar for Kotocycle 19. Kotocycle 1 pt. 6,829
  10. Avatar for Czech National Team 20. Czech National Team 1 pt. 0
  1. Avatar for Blipperman 11. Blipperman Lv 1 73 pts. 10,704
  2. Avatar for Heinermann 12. Heinermann Lv 1 70 pts. 10,704
  3. Avatar for Mike Cassidy 13. Mike Cassidy Lv 1 68 pts. 10,696
  4. Avatar for johnmitch 14. johnmitch Lv 1 66 pts. 10,676
  5. Avatar for actiasluna 15. actiasluna Lv 1 64 pts. 10,663
  6. Avatar for reefyrob 16. reefyrob Lv 1 61 pts. 10,662
  7. Avatar for nicobul 17. nicobul Lv 1 59 pts. 10,652
  8. Avatar for Galaxie 18. Galaxie Lv 1 57 pts. 10,643
  9. Avatar for vakobo 19. vakobo Lv 1 55 pts. 10,643
  10. Avatar for spmm 20. spmm Lv 1 53 pts. 10,638

Comments