Placeholder image of a protein
Icon representing a puzzle

1612: Unsolved De-novo Freestyle 139

Closed since about 7 years ago

Intermediate Overall Prediction

Summary

Created
December 20, 2018
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


PELEERLKTWLKIWYELMKKLLTWIAKVVSDEEFLKKVYKTMLEMMKEMWKILMEVLKKEEDLKKVIEIAIKFLIDLKRWMEDLKKKILS

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 11,121
  2. Avatar for Contenders 2. Contenders 78 pts. 11,068
  3. Avatar for Void Crushers 3. Void Crushers 60 pts. 10,974
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 45 pts. 10,907
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 33 pts. 10,850
  6. Avatar for Gargleblasters 6. Gargleblasters 24 pts. 10,720
  7. Avatar for Go Science 7. Go Science 17 pts. 10,672
  8. Avatar for Russian team 8. Russian team 12 pts. 10,643
  9. Avatar for Marvin's bunch 9. Marvin's bunch 8 pts. 10,627
  10. Avatar for FoldIt@Netherlands 10. FoldIt@Netherlands 6 pts. 10,508
  1. Avatar for Blipperman 11. Blipperman Lv 1 73 pts. 10,704
  2. Avatar for Heinermann 12. Heinermann Lv 1 70 pts. 10,704
  3. Avatar for Mike Cassidy 13. Mike Cassidy Lv 1 68 pts. 10,696
  4. Avatar for johnmitch 14. johnmitch Lv 1 66 pts. 10,676
  5. Avatar for actiasluna 15. actiasluna Lv 1 64 pts. 10,663
  6. Avatar for reefyrob 16. reefyrob Lv 1 61 pts. 10,662
  7. Avatar for nicobul 17. nicobul Lv 1 59 pts. 10,652
  8. Avatar for Galaxie 18. Galaxie Lv 1 57 pts. 10,643
  9. Avatar for vakobo 19. vakobo Lv 1 55 pts. 10,643
  10. Avatar for spmm 20. spmm Lv 1 53 pts. 10,638

Comments