Placeholder image of a protein
Icon representing a puzzle

1612: Unsolved De-novo Freestyle 139

Closed since about 7 years ago

Intermediate Overall Prediction

Summary

Created
December 20, 2018
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


PELEERLKTWLKIWYELMKKLLTWIAKVVSDEEFLKKVYKTMLEMMKEMWKILMEVLKKEEDLKKVIEIAIKFLIDLKRWMEDLKKKILS

Top groups

  1. Avatar for Hold My Beer 11. Hold My Beer 4 pts. 10,445
  2. Avatar for HMT heritage 12. HMT heritage 2 pts. 10,344
  3. Avatar for Deleted group 13. Deleted group pts. 9,224
  4. Avatar for Dutch Power Cows 14. Dutch Power Cows 1 pt. 9,088
  5. Avatar for freefolder 15. freefolder 1 pt. 8,896
  6. Avatar for DW 2020 16. DW 2020 1 pt. 8,572
  7. Avatar for Rechenkraft.net 17. Rechenkraft.net 1 pt. 8,264
  8. Avatar for FoldIt@Poland 18. FoldIt@Poland 1 pt. 6,869
  9. Avatar for Kotocycle 19. Kotocycle 1 pt. 6,829
  10. Avatar for Czech National Team 20. Czech National Team 1 pt. 0
  1. Avatar for DoctorSockrates 31. DoctorSockrates Lv 1 36 pts. 10,485
  2. Avatar for smilingone 32. smilingone Lv 1 34 pts. 10,473
  3. Avatar for Deleted player 33. Deleted player 33 pts. 10,473
  4. Avatar for dcrwheeler 34. dcrwheeler Lv 1 32 pts. 10,463
  5. Avatar for alwen 35. alwen Lv 1 31 pts. 10,459
  6. Avatar for guineapig 36. guineapig Lv 1 29 pts. 10,449
  7. Avatar for isaksson 37. isaksson Lv 1 28 pts. 10,448
  8. Avatar for Steven Pletsch 38. Steven Pletsch Lv 1 27 pts. 10,445
  9. Avatar for tarimo 39. tarimo Lv 1 26 pts. 10,438
  10. Avatar for cinnamonkitty 40. cinnamonkitty Lv 1 25 pts. 10,427

Comments