Placeholder image of a protein
Icon representing a puzzle

1612: Unsolved De-novo Freestyle 139

Closed since about 7 years ago

Intermediate Overall Prediction

Summary

Created
December 20, 2018
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


PELEERLKTWLKIWYELMKKLLTWIAKVVSDEEFLKKVYKTMLEMMKEMWKILMEVLKKEEDLKKVIEIAIKFLIDLKRWMEDLKKKILS

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 11,121
  2. Avatar for Contenders 2. Contenders 78 pts. 11,068
  3. Avatar for Void Crushers 3. Void Crushers 60 pts. 10,974
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 45 pts. 10,907
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 33 pts. 10,850
  6. Avatar for Gargleblasters 6. Gargleblasters 24 pts. 10,720
  7. Avatar for Go Science 7. Go Science 17 pts. 10,672
  8. Avatar for Russian team 8. Russian team 12 pts. 10,643
  9. Avatar for Marvin's bunch 9. Marvin's bunch 8 pts. 10,627
  10. Avatar for FoldIt@Netherlands 10. FoldIt@Netherlands 6 pts. 10,508
  1. Avatar for DoctorSockrates 31. DoctorSockrates Lv 1 36 pts. 10,485
  2. Avatar for smilingone 32. smilingone Lv 1 34 pts. 10,473
  3. Avatar for Deleted player 33. Deleted player 33 pts. 10,473
  4. Avatar for dcrwheeler 34. dcrwheeler Lv 1 32 pts. 10,463
  5. Avatar for alwen 35. alwen Lv 1 31 pts. 10,459
  6. Avatar for guineapig 36. guineapig Lv 1 29 pts. 10,449
  7. Avatar for isaksson 37. isaksson Lv 1 28 pts. 10,448
  8. Avatar for Steven Pletsch 38. Steven Pletsch Lv 1 27 pts. 10,445
  9. Avatar for tarimo 39. tarimo Lv 1 26 pts. 10,438
  10. Avatar for cinnamonkitty 40. cinnamonkitty Lv 1 25 pts. 10,427

Comments