Placeholder image of a protein
Icon representing a puzzle

1612: Unsolved De-novo Freestyle 139

Closed since over 7 years ago

Intermediate Overall Prediction

Summary


Created
December 20, 2018
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


PELEERLKTWLKIWYELMKKLLTWIAKVVSDEEFLKKVYKTMLEMMKEMWKILMEVLKKEEDLKKVIEIAIKFLIDLKRWMEDLKKKILS

Top groups


  1. Avatar for Hold My Beer 11. Hold My Beer 4 pts. 10,445
  2. Avatar for HMT heritage 12. HMT heritage 2 pts. 10,344
  3. Avatar for Deleted group 13. Deleted group pts. 9,224
  4. Avatar for Dutch Power Cows 14. Dutch Power Cows 1 pt. 9,088
  5. Avatar for freefolder 15. freefolder 1 pt. 8,896
  6. Avatar for DW 2020 16. DW 2020 1 pt. 8,572
  7. Avatar for Rechenkraft.net 17. Rechenkraft.net 1 pt. 8,264
  8. Avatar for FoldIt@Poland 18. FoldIt@Poland 1 pt. 6,869
  9. Avatar for Kotocycle 19. Kotocycle 1 pt. 6,829

  1. Avatar for jamiexq 51. jamiexq Lv 1 16 pts. 10,278
  2. Avatar for diamonddays 52. diamonddays Lv 1 15 pts. 10,251
  3. Avatar for pvc78 53. pvc78 Lv 1 14 pts. 10,181
  4. Avatar for silent gene 54. silent gene Lv 1 14 pts. 10,173
  5. Avatar for Maerlyn138 55. Maerlyn138 Lv 1 13 pts. 10,163
  6. Avatar for pfirth 56. pfirth Lv 1 12 pts. 10,160
  7. Avatar for benrh 57. benrh Lv 1 12 pts. 10,134
  8. Avatar for fpc 58. fpc Lv 1 11 pts. 10,088
  9. Avatar for Merf 59. Merf Lv 1 11 pts. 10,087
  10. Avatar for Susume 60. Susume Lv 1 10 pts. 10,034

Comments