Placeholder image of a protein
Icon representing a puzzle

1612: Unsolved De-novo Freestyle 139

Closed since about 7 years ago

Intermediate Overall Prediction

Summary

Created
December 20, 2018
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


PELEERLKTWLKIWYELMKKLLTWIAKVVSDEEFLKKVYKTMLEMMKEMWKILMEVLKKEEDLKKVIEIAIKFLIDLKRWMEDLKKKILS

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 11,121
  2. Avatar for Contenders 2. Contenders 78 pts. 11,068
  3. Avatar for Void Crushers 3. Void Crushers 60 pts. 10,974
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 45 pts. 10,907
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 33 pts. 10,850
  6. Avatar for Gargleblasters 6. Gargleblasters 24 pts. 10,720
  7. Avatar for Go Science 7. Go Science 17 pts. 10,672
  8. Avatar for Russian team 8. Russian team 12 pts. 10,643
  9. Avatar for Marvin's bunch 9. Marvin's bunch 8 pts. 10,627
  10. Avatar for FoldIt@Netherlands 10. FoldIt@Netherlands 6 pts. 10,508
  1. Avatar for jamiexq 51. jamiexq Lv 1 16 pts. 10,278
  2. Avatar for diamonddays 52. diamonddays Lv 1 15 pts. 10,251
  3. Avatar for pvc78 53. pvc78 Lv 1 14 pts. 10,181
  4. Avatar for silent gene 54. silent gene Lv 1 14 pts. 10,173
  5. Avatar for Maerlyn138 55. Maerlyn138 Lv 1 13 pts. 10,163
  6. Avatar for pfirth 56. pfirth Lv 1 12 pts. 10,160
  7. Avatar for benrh 57. benrh Lv 1 12 pts. 10,134
  8. Avatar for fpc 58. fpc Lv 1 11 pts. 10,088
  9. Avatar for Merf 59. Merf Lv 1 11 pts. 10,087
  10. Avatar for Susume 60. Susume Lv 1 10 pts. 10,034

Comments