Placeholder image of a protein
Icon representing a puzzle

1612: Unsolved De-novo Freestyle 139

Closed since about 7 years ago

Intermediate Overall Prediction

Summary

Created
December 20, 2018
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


PELEERLKTWLKIWYELMKKLLTWIAKVVSDEEFLKKVYKTMLEMMKEMWKILMEVLKKEEDLKKVIEIAIKFLIDLKRWMEDLKKKILS

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 11,121
  2. Avatar for Contenders 2. Contenders 78 pts. 11,068
  3. Avatar for Void Crushers 3. Void Crushers 60 pts. 10,974
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 45 pts. 10,907
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 33 pts. 10,850
  6. Avatar for Gargleblasters 6. Gargleblasters 24 pts. 10,720
  7. Avatar for Go Science 7. Go Science 17 pts. 10,672
  8. Avatar for Russian team 8. Russian team 12 pts. 10,643
  9. Avatar for Marvin's bunch 9. Marvin's bunch 8 pts. 10,627
  10. Avatar for FoldIt@Netherlands 10. FoldIt@Netherlands 6 pts. 10,508
  1. Avatar for komnor 121. komnor Lv 1 1 pt. 7,227
  2. Avatar for scottwuzhear 122. scottwuzhear Lv 1 1 pt. 7,210
  3. Avatar for J.Madzio 123. J.Madzio Lv 1 1 pt. 7,201
  4. Avatar for leehaggis 124. leehaggis Lv 1 1 pt. 7,188
  5. Avatar for rezaefar 125. rezaefar Lv 1 1 pt. 7,116
  6. Avatar for mikim2018 126. mikim2018 Lv 1 1 pt. 6,946
  7. Avatar for leannerikicheever 127. leannerikicheever Lv 1 1 pt. 6,908
  8. Avatar for oureion 128. oureion Lv 1 1 pt. 6,869
  9. Avatar for Ikuso 129. Ikuso Lv 1 1 pt. 6,829
  10. Avatar for lconor 130. lconor Lv 1 1 pt. 6,534

Comments