Placeholder image of a protein
Icon representing a puzzle

1614: Revisiting Puzzle 91: Virus Protein

Closed since over 7 years ago

Novice Overall Prediction

Summary

Created
December 27, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found on the surface of bacteriophage fd, a virus that infects E. coli. It is responsible for penetrating the cell membrane of the host bacteria, allowing virus to enter the cell. This protein contains four cysteines that oxidize to form two disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ETVESCLAKPHTENSFTNVWKDDKTLDRYANYEGCLWNATGVVVCTGDETQCYGTWVPIGLAIPENAAAH

Top groups

  1. Avatar for Hold My Beer 11. Hold My Beer 2 pts. 9,529
  2. Avatar for FoldIt@Netherlands 12. FoldIt@Netherlands 1 pt. 9,205
  3. Avatar for freefolder 13. freefolder 1 pt. 9,166
  4. Avatar for FoldIt@Poland 14. FoldIt@Poland 1 pt. 8,981
  5. Avatar for Trinity Biology 15. Trinity Biology 1 pt. 8,723
  6. Avatar for Dutch Power Cows 16. Dutch Power Cows 1 pt. 8,501
  7. Avatar for DSN @ Home 17. DSN @ Home 1 pt. 8,481
  8. Avatar for Rechenkraft.net 18. Rechenkraft.net 1 pt. 8,469
  1. Avatar for Squirrely 81. Squirrely Lv 1 3 pts. 9,055
  2. Avatar for ManVsYard 82. ManVsYard Lv 1 3 pts. 9,046
  3. Avatar for molleke 83. molleke Lv 1 2 pts. 9,040
  4. Avatar for pfirth 84. pfirth Lv 1 2 pts. 9,016
  5. Avatar for oureion 85. oureion Lv 1 2 pts. 8,981
  6. Avatar for jausmh 86. jausmh Lv 1 2 pts. 8,936
  7. Avatar for ivalnic 87. ivalnic Lv 1 2 pts. 8,926
  8. Avatar for RootBeerSwordsman 88. RootBeerSwordsman Lv 1 2 pts. 8,908
  9. Avatar for morris3190 89. morris3190 Lv 1 2 pts. 8,875
  10. Avatar for manu8170 90. manu8170 Lv 1 2 pts. 8,875

Comments