Placeholder image of a protein
Icon representing a puzzle

1620: Revisiting Puzzle 93: Spider Toxin

Closed since about 7 years ago

Novice Overall Prediction

Summary

Created
January 08, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small toxin is produced from the funnel-web spider A. aperta, and induces paralysis in insects by blocking calcium channels. This protein contains eight cysteines that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

KKKCIAKDYGRCKWGGTPCCRGRGCICSIMGTNCECKPRLIMEGLGLA

Top groups

  1. Avatar for Void Crushers
    1. Void Crushers
    100 pts. 9,911
  2. Avatar for Go Science 2. Go Science 76 pts. 9,893
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 56 pts. 9,874
  4. Avatar for Beta Folders 4. Beta Folders 41 pts. 9,866
  5. Avatar for Contenders 5. Contenders 29 pts. 9,779
  6. Avatar for Gargleblasters 6. Gargleblasters 20 pts. 9,763
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 14 pts. 9,736
  8. Avatar for Marvin's bunch 8. Marvin's bunch 9 pts. 9,712
  9. Avatar for HMT heritage 9. HMT heritage 6 pts. 9,675
  10. Avatar for Russian team 10. Russian team 4 pts. 9,663
  1. Avatar for tarimo 21. tarimo Lv 1 53 pts. 9,713
  2. Avatar for frood66 22. frood66 Lv 1 52 pts. 9,712
  3. Avatar for aznarog 23. aznarog Lv 1 50 pts. 9,704
  4. Avatar for Sissue 24. Sissue Lv 1 48 pts. 9,694
  5. Avatar for silent gene 25. silent gene Lv 1 47 pts. 9,690
  6. Avatar for O Seki To 26. O Seki To Lv 1 45 pts. 9,675
  7. Avatar for phi16 27. phi16 Lv 1 43 pts. 9,650
  8. Avatar for Deleted player 28. Deleted player 42 pts. 9,642
  9. Avatar for robgee 29. robgee Lv 1 40 pts. 9,635
  10. Avatar for orily1337 30. orily1337 Lv 1 39 pts. 9,631

Comments