Placeholder image of a protein
Icon representing a puzzle

1620: Revisiting Puzzle 93: Spider Toxin

Closed since about 7 years ago

Novice Overall Prediction

Summary

Created
January 08, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small toxin is produced from the funnel-web spider A. aperta, and induces paralysis in insects by blocking calcium channels. This protein contains eight cysteines that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

KKKCIAKDYGRCKWGGTPCCRGRGCICSIMGTNCECKPRLIMEGLGLA

Top groups

  1. Avatar for Void Crushers
    1. Void Crushers
    100 pts. 9,911
  2. Avatar for Go Science 2. Go Science 76 pts. 9,893
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 56 pts. 9,874
  4. Avatar for Beta Folders 4. Beta Folders 41 pts. 9,866
  5. Avatar for Contenders 5. Contenders 29 pts. 9,779
  6. Avatar for Gargleblasters 6. Gargleblasters 20 pts. 9,763
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 14 pts. 9,736
  8. Avatar for Marvin's bunch 8. Marvin's bunch 9 pts. 9,712
  9. Avatar for HMT heritage 9. HMT heritage 6 pts. 9,675
  10. Avatar for Russian team 10. Russian team 4 pts. 9,663
  1. Avatar for cobaltteal 81. cobaltteal Lv 1 4 pts. 8,753
  2. Avatar for Pibeagles1 82. Pibeagles1 Lv 1 4 pts. 8,747
  3. Avatar for atlas100 83. atlas100 Lv 1 4 pts. 8,743
  4. Avatar for felixxy 84. felixxy Lv 1 4 pts. 8,695
  5. Avatar for rabamino12358 85. rabamino12358 Lv 1 4 pts. 8,678
  6. Avatar for Vincera 86. Vincera Lv 1 3 pts. 8,640
  7. Avatar for RyeSnake 87. RyeSnake Lv 1 3 pts. 8,628
  8. Avatar for Squirrely 88. Squirrely Lv 1 3 pts. 8,598
  9. Avatar for Alistair69 89. Alistair69 Lv 1 3 pts. 8,570
  10. Avatar for antibot215 90. antibot215 Lv 1 3 pts. 8,500

Comments