Placeholder image of a protein
Icon representing a puzzle

1628: Unsolved De-novo Freestyle 144

Closed since about 7 years ago

Intermediate Overall Prediction

Summary

Created
January 24, 2019
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

TEEEAKKALAEAKKHVEEARRQGKSAEAEKEAQKAEKKGERHARRGTTRKPEELARRGADEAREEGKRME

Top groups

  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 1 pt. 9,926
  2. Avatar for HMT heritage 12. HMT heritage 1 pt. 9,895
  3. Avatar for freefolder 13. freefolder 1 pt. 9,313
  4. Avatar for Mojo Risin' 14. Mojo Risin' 1 pt. 9,276
  5. Avatar for DW 2020 15. DW 2020 1 pt. 9,265
  6. Avatar for Coastal Biochemistry 16. Coastal Biochemistry 1 pt. 8,537
  1. Avatar for SmallHummingBird 111. SmallHummingBird Lv 1 1 pt. 8,210
  2. Avatar for gdnskye 112. gdnskye Lv 1 1 pt. 8,110
  3. Avatar for Fowardint 113. Fowardint Lv 1 1 pt. 8,074
  4. Avatar for altejoh 114. altejoh Lv 1 1 pt. 8,020
  5. Avatar for luwachamo 115. luwachamo Lv 1 1 pt. 7,875
  6. Avatar for mikim2018 116. mikim2018 Lv 1 1 pt. 7,837
  7. Avatar for caseymcdonald 117. caseymcdonald Lv 1 1 pt. 7,739
  8. Avatar for emdee314 118. emdee314 Lv 1 1 pt. 7,599
  9. Avatar for tornsage 119. tornsage Lv 1 1 pt. 7,379
  10. Avatar for erobo314 120. erobo314 Lv 1 1 pt. 7,370

Comments