Placeholder image of a protein
Icon representing a puzzle

1628: Unsolved De-novo Freestyle 144

Closed since about 7 years ago

Intermediate Overall Prediction

Summary

Created
January 24, 2019
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

TEEEAKKALAEAKKHVEEARRQGKSAEAEKEAQKAEKKGERHARRGTTRKPEELARRGADEAREEGKRME

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 10,357
  2. Avatar for L'Alliance Francophone 2. L'Alliance Francophone 71 pts. 10,249
  3. Avatar for Go Science 3. Go Science 49 pts. 10,241
  4. Avatar for Gargleblasters 4. Gargleblasters 33 pts. 10,227
  5. Avatar for Anthropic Dreams 5. Anthropic Dreams 22 pts. 10,226
  6. Avatar for Hold My Beer 6. Hold My Beer 14 pts. 10,206
  7. Avatar for Marvin's bunch 7. Marvin's bunch 8 pts. 10,176
  8. Avatar for Contenders 8. Contenders 5 pts. 10,162
  9. Avatar for Void Crushers 9. Void Crushers 3 pts. 10,138
  10. Avatar for Russian team 10. Russian team 2 pts. 10,097
  1. Avatar for SmallHummingBird 111. SmallHummingBird Lv 1 1 pt. 8,210
  2. Avatar for gdnskye 112. gdnskye Lv 1 1 pt. 8,110
  3. Avatar for Fowardint 113. Fowardint Lv 1 1 pt. 8,074
  4. Avatar for altejoh 114. altejoh Lv 1 1 pt. 8,020
  5. Avatar for luwachamo 115. luwachamo Lv 1 1 pt. 7,875
  6. Avatar for mikim2018 116. mikim2018 Lv 1 1 pt. 7,837
  7. Avatar for caseymcdonald 117. caseymcdonald Lv 1 1 pt. 7,739
  8. Avatar for emdee314 118. emdee314 Lv 1 1 pt. 7,599
  9. Avatar for tornsage 119. tornsage Lv 1 1 pt. 7,379
  10. Avatar for erobo314 120. erobo314 Lv 1 1 pt. 7,370

Comments