Placeholder image of a protein
Icon representing a puzzle

1628: Unsolved De-novo Freestyle 144

Closed since about 7 years ago

Intermediate Overall Prediction

Summary

Created
January 24, 2019
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

TEEEAKKALAEAKKHVEEARRQGKSAEAEKEAQKAEKKGERHARRGTTRKPEELARRGADEAREEGKRME

Top groups

  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 1 pt. 9,926
  2. Avatar for HMT heritage 12. HMT heritage 1 pt. 9,895
  3. Avatar for freefolder 13. freefolder 1 pt. 9,313
  4. Avatar for Mojo Risin' 14. Mojo Risin' 1 pt. 9,276
  5. Avatar for DW 2020 15. DW 2020 1 pt. 9,265
  6. Avatar for Coastal Biochemistry 16. Coastal Biochemistry 1 pt. 8,537
  1. Avatar for Hellcat6 21. Hellcat6 Lv 1 44 pts. 10,087
  2. Avatar for DoctorSockrates 22. DoctorSockrates Lv 1 42 pts. 10,083
  3. Avatar for georg137 23. georg137 Lv 1 40 pts. 10,078
  4. Avatar for boondog 24. boondog Lv 1 38 pts. 10,069
  5. Avatar for robgee 25. robgee Lv 1 36 pts. 10,056
  6. Avatar for crpainter 26. crpainter Lv 1 35 pts. 10,040
  7. Avatar for Glen B 27. Glen B Lv 1 33 pts. 10,034
  8. Avatar for pvc78 28. pvc78 Lv 1 31 pts. 10,034
  9. Avatar for orily1337 29. orily1337 Lv 1 30 pts. 10,021
  10. Avatar for nicobul 30. nicobul Lv 1 28 pts. 10,015

Comments